PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun004620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 217aa    MW: 25239 Da    PI: 6.5498
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-5935361PU_refplantGDBView CDS
gnl|UG|Vun#S45816723PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-193486456
               -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +++f++eq++ Le  Fe ++++  +++ +LA+ lgL+ rqV +WFqNrRa++k
  Vun004620 34 KRRFSDEQIRSLECIFETESKLEPRKKMQLARDLGLQPRQVAIWFQNRRARWK 86
               568*************************************************9 PP

2HD-ZIP_I/II1231.4e-3932124193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  e+krr+s+eq+++LE  Fe+e+kLep++K++lar+Lglqprqva+WFqnrRAR+k+k++E++y++Lk++yd+l+++ e+L+ke+e+L+ el++
    Vun004620  32 ENKRRFSDEQIRSLECIFETESKLEPRKKMQLARDLGLQPRQVAIWFQNRRARWKSKRIEQEYRKLKDEYDNLASRFESLKKEKESLQVELQK 124
                  58**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.06E-182388IPR009057Homeodomain-like
PROSITE profilePS5007117.5242888IPR001356Homeobox domain
SMARTSM003893.0E-163192IPR001356Homeobox domain
PfamPF000465.6E-173486IPR001356Homeobox domain
CDDcd000862.64E-133489No hitNo description
Gene3DG3DSA:1.10.10.605.5E-193495IPR009057Homeodomain-like
PRINTSPR000317.2E-65968IPR000047Helix-turn-helix motif
PROSITE patternPS0002706386IPR017970Homeobox, conserved site
PRINTSPR000317.2E-66884IPR000047Helix-turn-helix motif
PfamPF021837.3E-1288128IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MEGDENIQAS KGKNVESFTS LEAPRRKNKK IENKRRFSDE QIRSLECIFE TESKLEPRKK  60
MQLARDLGLQ PRQVAIWFQN RRARWKSKRI EQEYRKLKDE YDNLASRFES LKKEKESLQV  120
ELQKLSDLVV SSHDGGREDK GGKEHSIEDG GSGSGYSSWK PEEKPRFSNE GLEERVGVYS  180
DDQNENSMMR SEKSEDKGHQ VLRMDDNDHA EMPLASL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014517123.11e-143PREDICTED: homeobox-leucine zipper protein ATHB-12-like
SwissprotP468971e-45ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLA0A0S3RDW71e-143A0A0S3RDW7_PHAAN; Uncharacterized protein
STRINGGLYMA06G13890.11e-129(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.11e-42homeobox 7